DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and psma1

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001003427.1 Gene:psma1 / 445033 ZFINID:ZDB-GENE-040801-15 Length:262 Species:Danio rerio


Alignment Length:244 Identity:72/244 - (29%)
Similarity:121/244 - (49%) Gaps:19/244 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTH---LF 70
            :|..:|::||:||::|:|||.:|:.|.: .||.|||...||:...|:...     |...|   :.
Zfish     6 YDNDVTVWSPQGRIHQIEYAMEAVKQGS-ATVGLKSHSHAVLVALKRAQS-----ELAAHQKKIL 64

  Fly    71 RITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLG 135
            .:...||.::.|..||:|......|.|..:.|:.:...:||..|...|....|:.||....||.|
Zfish    65 HVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYG 129

  Fly   136 CSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKP----NLSEEKAIQLA 196
            ..:::..|| ::||.:::|.|:..:...||.|:||::..|.:|||:..:.    ||:  ..:|..
Zfish   130 VGLLIAGYD-DMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMEAFNDCNLN--ALVQHG 191

  Fly   197 ISCLSSVLAI--DFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEK 243
            :..|...|..  |.....:.||:|.| |..|.|.|:.::...|..:.|:
Zfish   192 LRALRETLPAEQDLTTKNVSIGIVGK-DMEFTIYDDDDVATFLQGLEER 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 71/242 (29%)
proteasome_alpha_type_6 8..218 CDD:239723 64/217 (29%)
psma1NP_001003427.1 PRK03996 1..238 CDD:235192 71/241 (29%)
proteasome_alpha_type_1 6..216 CDD:239718 64/218 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.