DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and Prosalpha3T

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster


Alignment Length:234 Identity:80/234 - (34%)
Similarity:122/234 - (52%) Gaps:12/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73
            ||...|||||||||||||||.:|.:|.. |.|.|.:.:..::||::.|.:.......|..:..:.
  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSG-TCVGLLAKNGVLLATERSVDKLMDTSIPVPRISWLN 68

  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSM 138
            ::|.|..||..||....|.:.|..|..:::.:|..:|.:.|...:.||.|.|||....||.|.|.
  Fly    69 ENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSF 133

  Fly   139 VLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKK------YKPNLSEEKAIQLAI 197
            :.:.:|...|..:|::||:|.:||:||..:|.|:..|...|:|:      ..|::.|.|  .:||
  Fly   134 LYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAK--DVAI 196

  Fly   198 SCLSSVLAID-FKPNGIEIGVVSKSDPT--FRILDEREI 233
            ..:...|..| ..|..:||..|.:...|  |.||::.||
  Fly   197 KVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 80/234 (34%)
proteasome_alpha_type_6 8..218 CDD:239723 73/215 (34%)
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 80/234 (34%)
Ntn_hydrolase 3..218 CDD:294319 73/215 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441040
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.