DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and Prosalpha2

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster


Alignment Length:228 Identity:70/228 - (30%)
Similarity:121/228 - (53%) Gaps:4/228 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRITKDIG 77
            :|.|||.|:|.|:|||..|:: ....:|.:.:.:..|:||:.|.........:|..:..|...||
  Fly    10 LTTFSPSGKLVQLEYALAAVS-GGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIYNHIG 73

  Fly    78 CAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMVLIA 142
            ...:|...|.|..|::||..|..:...|...:||..|.:|:|.:.|.|||:..:||.|.|:::..
  Fly    74 MVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICG 138

  Fly   143 YDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAID 207
            :||: .|.:|::||:|.:..:||.::|...:...::|||:|..:|..:.|:..||..|.......
  Fly   139 WDND-RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLKEGFEGK 202

  Fly   208 FKPNGIEIGVVSKSDPTFRILDEREIEEHLTKI 240
            ...:.||||:..::.  |:.||...|:::|..|
  Fly   203 MTADNIEIGICDQNG--FQRLDPASIKDYLASI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 70/228 (31%)
proteasome_alpha_type_6 8..218 CDD:239723 64/204 (31%)
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 68/224 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441018
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.