DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and Prosbeta7

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster


Alignment Length:203 Identity:38/203 - (18%)
Similarity:78/203 - (38%) Gaps:29/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVP-ETVTHLFRITK 74
            |.:|...|.|..:..     |.:....:.:.::.....::|....|:..::.. :.:..:|::.|
  Fly    37 RELTTMGPYGTKHST-----ASSTTGTSVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNK 96

  Fly    75 DIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLC--------RRIAD--INQVYTQNA 129
            :|....:|..||.:|           .:.....:|..|..|        :.:|.  ...:|.:.:
  Fly    97 NILLGGSGDFADIQS-----------IKRNIDQKMIEDQCCDDNIEMKPKSLASWMTRVLYNRRS 150

  Fly   130 EMRPLGCSMVLIAYDNEIGPSVYKTDPAG-YFSGFKACSVGAKTLEANSYLEKKYKP-NLSEEKA 192
            .|.||...:|:...|||..|.:...|..| .:..:...:..|:.|......|||.|. :.:..:|
  Fly   151 RMNPLYIDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATGFARHLAVPLVREKKPKDRDFTAVEA 215

  Fly   193 IQLAISCL 200
            .:|..:|:
  Fly   216 SELIRTCM 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 38/203 (19%)
proteasome_alpha_type_6 8..218 CDD:239723 38/203 (19%)
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 33/175 (19%)
PRE1 60..232 CDD:223711 33/175 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441042
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.