DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and psma6

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_989113.1 Gene:psma6 / 394718 XenbaseID:XB-GENE-943786 Length:246 Species:Xenopus tropicalis


Alignment Length:246 Identity:166/246 - (67%)
Similarity:200/246 - (81%) Gaps:2/246 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPET 65
            ||||||||||||||||||||||||||||||||.|..:|:||::..|||||.||:||.:|.:...|
 Frog     1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKLLDSNT 65

  Fly    66 VTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAE 130
            ||||||||:.|||.|||..||||||||:|||||||::||||||:|||:||:|||||:||||||||
 Frog    66 VTHLFRITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAE 130

  Fly   131 MRPLGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNL--SEEKAI 193
            ||||||.|:||..|.|.||.|:|.|||||:.||||.:.|.|..||.|:||||.|..|  :.|:.:
 Frog   131 MRPLGCCMILIGVDEENGPQVFKCDPAGYYCGFKATTAGVKQTEATSFLEKKVKKKLDWTYEQTL 195

  Fly   194 QLAISCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244
            :.||||||:||:|||||:.:|:|||:..||.||:|.|.||:.||..:||:|
 Frog   196 ETAISCLSTVLSIDFKPSELEVGVVTVEDPKFRVLTEAEIDVHLVALAERD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 158/237 (67%)
proteasome_alpha_type_6 8..218 CDD:239723 144/211 (68%)
psma6NP_989113.1 proteasome_alpha_type_6 8..220 CDD:239723 144/211 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 247 1.000 Domainoid score I2116
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2085
Inparanoid 1 1.050 338 1.000 Inparanoid score I2335
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002933
OrthoInspector 1 1.000 - - oto104658
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1008
SonicParanoid 1 1.000 - - X1933
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.080

Return to query results.
Submit another query.