DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and Psma8

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001102354.1 Gene:Psma8 / 364814 RGDID:1311659 Length:250 Species:Rattus norvegicus


Alignment Length:241 Identity:80/241 - (33%)
Similarity:133/241 - (55%) Gaps:11/241 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73
            :||.||:|||:|.|:|||||.:|: ::..|.|.::..:..|:..:||...|.....||..:..:.
  Rat     5 YDRAITVFSPDGHLFQVEYAQEAV-KKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKICALD 68

  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDV--LCRRIADINQVYTQNAEMRPLGC 136
            ..:..|..|..||:|..:.:||.|..:  :|...|.||.|  :.|.||.:.|.|||:...||.|.
  Rat    69 DHVCMAFAGLTADARVVISRARVECQS--HKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGI 131

  Fly   137 SMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNL--SEEKAIQLAISC 199
            |.:::.:|::..|.:|:|||:|.:..:||.::|........:|||.|..:.  ::.:||:|||..
  Rat   132 SALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAISNDNEAIKLAIKA 196

  Fly   200 LSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKI-AEKD 244
            |..|:....|  .||:.::.:..| .::...:|||..:|:| .|||
  Rat   197 LLEVVQSGGK--NIELAIIRRDQP-LKMFSAKEIELEVTEIEREKD 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 77/238 (32%)
proteasome_alpha_type_6 8..218 CDD:239723 71/212 (33%)
Psma8NP_001102354.1 PRK03996 5..234 CDD:235192 76/234 (32%)
proteasome_alpha_type_7 5..213 CDD:239724 71/212 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.