DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and Prosbeta2R1

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster


Alignment Length:218 Identity:49/218 - (22%)
Similarity:87/218 - (39%) Gaps:23/218 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ALKSG---------DCAVVATQKKVTEKNIVPE-TVTHLFRITKDIGCAMTGRIADSR--SQVQK 93
            |:|:|         |..::....:.||..||.: ..:.:..:...|.|...|..||:.  :....
  Fly    44 AIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTS 108

  Fly    94 ARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMVLIAYDNEIGPSVYKTDPAG 158
            |..:.    ::...|..|.|:|..:.....::.....   :|.::|:...|. .||.:|...|.|
  Fly   109 AELDL----HRLNTERRVPVVCASMMLRRTLFRYQGH---IGAALVMGGVDT-TGPQLYCIYPCG 165

  Fly   159 YFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAIDF-KPNGIEIGVVSKSD 222
            ........::|:.||.|.|.||..:||:|..|:..||....:|:.:..|. ..:.|::.|::...
  Fly   166 SNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVITAKG 230

  Fly   223 PTFRILD--EREIEEHLTKIAEK 243
            ..:...|  ..|..|.|.|...|
  Fly   231 AVYLRTDTIASEKGERLGKYGIK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 48/216 (22%)
proteasome_alpha_type_6 8..218 CDD:239723 42/189 (22%)
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 42/200 (21%)
proteasome_beta_type_7 49..236 CDD:239732 40/194 (21%)
Pr_beta_C 241..274 CDD:289249 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.