DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and psmb8a

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_571467.3 Gene:psmb8a / 30666 ZFINID:ZDB-GENE-990415-141 Length:271 Species:Danio rerio


Alignment Length:161 Identity:33/161 - (20%)
Similarity:67/161 - (41%) Gaps:10/161 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TTVALKSGDCAVVATQKKVTE-KNIVPETVTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANF 101
            ||:|.|.....:||...:.:. |.|..:....:..|...:...|:|..||.:...:....|...:
Zfish    69 TTLAFKFRHGVIVAVDSRASAGKYIASKEANKVIEINPYLLGTMSGSAADCQYWERLLAKECRLY 133

  Fly   102 RYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSM--VLIAYDNEIGPSVYKTDPAGYFSGFK 164
            :.:....:.|....:.::::...|      |.:|.||  ::..:|.: ||.:|..|..|.....:
Zfish   134 KLRNKQRISVSAASKLLSNMMLGY------RGMGLSMGSMICGWDKQ-GPGLYYVDDNGTRLSGR 191

  Fly   165 ACSVGAKTLEANSYLEKKYKPNLSEEKAIQL 195
            ..|.|.....|...::..|:.:::.|:|.:|
Zfish   192 MFSTGCGNSYAYGVVDSGYREDMTVEEAYEL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 33/161 (20%)
proteasome_alpha_type_6 8..218 CDD:239723 33/161 (20%)
psmb8aNP_571467.3 PTZ00488 37..266 CDD:185666 33/161 (20%)
proteasome_beta_type_5 68..255 CDD:239730 33/161 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.