DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and Psma6

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_058979.1 Gene:Psma6 / 29673 RGDID:61849 Length:246 Species:Rattus norvegicus


Alignment Length:246 Identity:164/246 - (66%)
Similarity:200/246 - (81%) Gaps:2/246 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPET 65
            ||||||||||||||||||||||||||||||||.|..:|:||::..||||:.|||||.:|.:...|
  Rat     1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSST 65

  Fly    66 VTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAE 130
            |||||:||::|||.|||..||||||||:|||||||::||||||:|||:||:|||||:||||||||
  Rat    66 VTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAE 130

  Fly   131 MRPLGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNL--SEEKAI 193
            ||||||.|:||..|.|.||.|||.|||||:.||||.:.|.|..|:.|:||||.|...  :.|:.:
  Rat   131 MRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTV 195

  Fly   194 QLAISCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244
            :.||:|||:||:|||||:.||:|||:..:|.||||.|.||:.||..:||:|
  Rat   196 ETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 156/237 (66%)
proteasome_alpha_type_6 8..218 CDD:239723 142/211 (67%)
Psma6NP_058979.1 proteasome_alpha_type_6 8..220 CDD:239723 142/211 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353625
Domainoid 1 1.000 245 1.000 Domainoid score I2123
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2085
Inparanoid 1 1.050 336 1.000 Inparanoid score I2320
OMA 1 1.010 - - QHG53623
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002933
OrthoInspector 1 1.000 - - oto97965
orthoMCL 1 0.900 - - OOG6_102240
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1933
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.