DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and Psma4

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_058977.1 Gene:Psma4 / 29671 RGDID:61846 Length:261 Species:Rattus norvegicus


Alignment Length:245 Identity:71/245 - (28%)
Similarity:133/245 - (54%) Gaps:8/245 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETV--TH 68
            |..:|...|||||||||||||||.:||.... |.:.:.:.|..::|.:::...| ::.|..  ..
  Rat     2 SRRYDSRTTIFSPEGRLYQVEYAMEAIGHAG-TCLGILANDGVLLAAERRNIHK-LLDEVFFSEK 64

  Fly    69 LFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRP 133
            ::::.:|:.|::.|..:|:.....:.|..|..:..:|...:|.:.|...:.||.|.|||....||
  Rat    65 IYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRP 129

  Fly   134 LGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKP-NLSEEKAIQLAI 197
            .|.|::.|.:|...|..:|::||:|.:.|:||..:|..:..|.|.|::.||. .::.:.|:.||:
  Rat   130 FGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAV 194

  Fly   198 SCLSSVLAID-FKPNGIEIGVVSKSD--PTFRILDEREIEEHLTKIAEKD 244
            ..|:..:.:. .....:||..:::.:  ...|:|.::|:|:.:.|..|::
  Rat   195 KVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 69/241 (29%)
proteasome_alpha_type_6 8..218 CDD:239723 64/213 (30%)
Psma4NP_058977.1 proteasome_alpha_type_4 3..216 CDD:239721 64/214 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.