DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and Psmb10

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001020808.1 Gene:Psmb10 / 291983 RGDID:1307428 Length:273 Species:Rattus norvegicus


Alignment Length:185 Identity:40/185 - (21%)
Similarity:80/185 - (43%) Gaps:12/185 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IAQENITTVA-LKSGDCAVVATQKKVTEKNIVPE-TVTHLFRITKDIGCAMTGRIADSRSQVQKA 94
            :|::..||:| |...|..::....:.|..::|.: :...:..|...|.|...|..||:....:.|
  Rat    34 LARKTGTTIAGLVFRDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADTEMTTRMA 98

  Fly    95 RYEAANFRYKYGYEMPVDVLCRRIADINQVYTQN--AEMRPLGCSMVLIAYDNEIGPSVYKTDPA 157
            ..:........|.|       .|:|.:.::..|.  .....:|.|:::...|.. ||.:|...|.
  Rat    99 ASKMELHALSTGRE-------PRVATVTRILRQTLFRYQGHVGASLIVGGVDLN-GPQLYSVHPH 155

  Fly   158 GYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAIDFKPNG 212
            |.:|.....::|:....|.:.||.:::||::.|.|.:|.:..:::.:..|....|
  Rat   156 GSYSRLPFTALGSGQDAAVALLEDRFQPNMTLEAAQELLVEAITAGILGDLGSGG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 40/185 (22%)
proteasome_alpha_type_6 8..218 CDD:239723 40/185 (22%)
Psmb10NP_001020808.1 proteasome_beta_type_7 40..226 CDD:239732 39/179 (22%)
Pr_beta_C 233..267 CDD:403609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.