DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and Psma5

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_036097.1 Gene:Psma5 / 26442 MGIID:1347009 Length:241 Species:Mus musculus


Alignment Length:237 Identity:69/237 - (29%)
Similarity:128/237 - (54%) Gaps:8/237 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73
            :||.:..|||||||:|||||.:|| :...|.:.:::.:...:|.:|::|...:.|.::..:..|.
Mouse     8 YDRGVNTFSPEGRLFQVEYAIEAI-KLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEID 71

  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQ-----NAEMRP 133
            ..|||||:|.|||:::.:.|||.|..|..:.|...|.|:.:.:.::::...:.:     .|..||
Mouse    72 AHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRP 136

  Fly   134 LGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAIS 198
            .|.:::....| |.||.::..||:|.|....|.::|:.:..|.|.|::.|..:::.::||:.::.
Mouse   137 FGVALLFGGVD-EKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLI 200

  Fly   199 CLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKI 240
            .|..|:........||:..|.... .|.:..:.|:||.:..|
Mouse   201 ILKQVMEEKLNATNIELATVQPGQ-NFHMFTKEELEEVIKDI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 69/237 (29%)
proteasome_alpha_type_6 8..218 CDD:239723 63/213 (30%)
Psma5NP_036097.1 proteasome_alpha_type_5 8..220 CDD:239722 63/213 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.