DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and Psmb7

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_035317.1 Gene:Psmb7 / 19177 MGIID:107637 Length:277 Species:Mus musculus


Alignment Length:255 Identity:55/255 - (21%)
Similarity:98/255 - (38%) Gaps:72/255 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ITIFSP-----------EGRLYQVEYAFKAI----AQENITTVA---LKSGDCAVVATQKKVTEK 59
            :::|.|           ...:.:.::|.|..    |::..||:|   .|.|  .|:....:.||.
Mouse     4 VSVFQPPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDG--IVLGADTRATEG 66

  Fly    60 NIVPE-TVTHLFRITKDIGCAMTGRIADSRSQVQ---------------KARYEAAN-------F 101
            .:|.: ..:.:..|:.:|.|...|..||:....|               ..|...||       |
Mouse    67 MVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLF 131

  Fly   102 RYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKAC 166
            ||: ||                          :|.::||...| ..||.:|...|.|........
Mouse   132 RYQ-GY--------------------------IGAALVLGGVD-VTGPHLYSIYPHGSTDKLPYV 168

  Fly   167 SVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAIDF-KPNGIEIGVVSKSDPTF 225
            ::|:.:|.|.:..|.|::|::.||:|.:|....:::.:..|. ..:.|::.|:|||...|
Mouse   169 TMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDF 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 55/255 (22%)
proteasome_alpha_type_6 8..218 CDD:239723 50/246 (20%)
Psmb7NP_035317.1 PRE1 41..225 CDD:223711 48/213 (23%)
proteasome_beta_type_7 44..232 CDD:239732 50/215 (23%)
Pr_beta_C 236..271 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.