DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and pas-1

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_506571.1 Gene:pas-1 / 179941 WormBaseID:WBGene00003922 Length:246 Species:Caenorhabditis elegans


Alignment Length:246 Identity:130/246 - (52%)
Similarity:180/246 - (73%) Gaps:2/246 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPET 65
            |||||||||||||||||||||:||||||||||...|:|.||:|..|.||:|.||:|.:..||.:|
 Worm     1 MSRGSSAGFDRHITIFSPEGRVYQVEYAFKAINSTNLTAVAVKGADAAVIAVQKRVPDSLIVADT 65

  Fly    66 VTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAE 130
            ||.:::|::.:||...|.|.|::.|:::|:.|||:::||.||:||.::|.:::||:||.||||||
 Worm    66 VTSVYQISQSVGCCAIGMIPDAKFQIKRAQGEAASWKYKNGYDMPCELLAKKMADLNQYYTQNAE 130

  Fly   131 MRPLGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKY--KPNLSEEKAI 193
            ||.|||:::.|:||:|.||.||:.|||||:.|.|..|||.|.|.|.|:||||.  |..|:..:||
 Worm   131 MRSLGCALLFISYDDEKGPEVYRVDPAGYYRGMKGVSVGVKQLPATSFLEKKIKKKSELTSTEAI 195

  Fly   194 QLAISCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244
            :|||..|.:.|.||.:...:|:.||:|.:..|..|...::|.||.:||.:|
 Worm   196 ELAIEALQTSLGIDVRSKDLEVVVVTKDNSKFTKLTSDQVEHHLNQIANRD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 123/237 (52%)
proteasome_alpha_type_6 8..218 CDD:239723 112/211 (53%)
pas-1NP_506571.1 PRE1 7..245 CDD:223711 123/237 (52%)
proteasome_alpha_type_6 8..220 CDD:239723 112/211 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167131
Domainoid 1 1.000 186 1.000 Domainoid score I1999
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2085
Inparanoid 1 1.050 268 1.000 Inparanoid score I1859
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53623
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002933
OrthoInspector 1 1.000 - - oto20181
orthoMCL 1 0.900 - - OOG6_102240
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1008
SonicParanoid 1 1.000 - - X1933
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.