DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and pas-6

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_504472.1 Gene:pas-6 / 178943 WormBaseID:WBGene00003927 Length:260 Species:Caenorhabditis elegans


Alignment Length:241 Identity:66/241 - (27%)
Similarity:120/241 - (49%) Gaps:17/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73
            :|..:|::||:|||:|||||.:|:.|.: .||.:||...||:...|:.  :|.:......::.|.
 Worm     6 YDGDVTVWSPQGRLHQVEYAVEAMKQGS-ATVGIKSETHAVIVALKRA--QNDLSSHQKKVYEID 67

  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSM 138
            ...|.::.|.::|.|...:..:.|.:::|:.|...:|:..|...:....|..||....||.|..:
 Worm    68 THAGVSIAGLLSDGRILARYLQTECSSWRWDYKQAVPIKKLAESMQLKLQANTQYYGRRPFGVGI 132

  Fly   139 VLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSV 203
            ::..||.: |..:.:|||:.........|:||::..|.:|||:.. .|..:....||.:..|   
 Worm   133 LIAGYDKD-GAHIIQTDPSAEVVSMHGTSIGARSQSARTYLERNV-DNFEKSTPEQLIVHAL--- 192

  Fly   204 LAI--------DFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIA 241
            ||:        :.......||:|.|..| |.:|::.::..||.:::
 Worm   193 LALRDTLPAEENLNAQNTSIGIVGKDSP-FSLLEDAQVAVHLNQVS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 66/241 (27%)
proteasome_alpha_type_6 8..218 CDD:239723 59/216 (27%)
pas-6NP_504472.1 PRE1 4..237 CDD:223711 66/239 (28%)
proteasome_alpha_type_1 6..216 CDD:239718 59/217 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.