DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30382 and pbs-2

DIOPT Version :9

Sequence 1:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_493271.1 Gene:pbs-2 / 173168 WormBaseID:WBGene00003948 Length:277 Species:Caenorhabditis elegans


Alignment Length:192 Identity:42/192 - (21%)
Similarity:79/192 - (41%) Gaps:10/192 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ITTVALKSGDCAVVATQKKVTEKNIVPET-VTHLFRITKDIGCAMTGRIADSRSQVQKARYEAAN 100
            |..||.|.|  .|:....:.|..||:.:. ...:.::|:.|.....|..|| ..||.|..  :.|
 Worm    49 IVAVAFKGG--LVMGADSRATAGNIIADKHCEKVHKLTESIYACGAGTAAD-LDQVTKML--SGN 108

  Fly   101 FRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKA 165
            .|.   .|:......|.|..:.|........:....:.:||...:..||.:|.....|....|..
 Worm   109 LRL---LELNTGRKARVITALRQAKQHLFNYQGYIGAYLLIGGVDPTGPHLYMCSANGTTMAFPF 170

  Fly   166 CSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAID-FKPNGIEIGVVSKSDPTFR 226
            .:.|:.:..|.:.||:.:|.::::::|.:|....|.:.:..| ...|.:.:.::..|:..|:
 Worm   171 TAQGSGSYAAITILERDFKVDMTKDEAEKLVQRALEAGMHGDNASGNSLNLVIIEPSETVFK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 42/192 (22%)
proteasome_alpha_type_6 8..218 CDD:239723 40/182 (22%)
pbs-2NP_493271.1 PRE1 43..228 CDD:223711 40/186 (22%)
proteasome_beta_type_7 47..235 CDD:239732 42/192 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.