DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and Clic5

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:171 Identity:38/171 - (22%)
Similarity:63/171 - (36%) Gaps:41/171 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NLLAGEHKTKEFSLKN--PQHTVPVLEDDGKFIWESHAICAYLVRRYAKSDDLYPKDYFKRALVD 97
            |:...:.|.|...|.|  |....|.|..:|....:.:.|..:|      .:.|.|:.|.|.|   
  Rat    50 NVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFL------EETLTPEKYPKLA--- 105

  Fly    98 QRLHFESGVL-------FQGCIRNIAIPLFYKNITEVPRSQIDAIYEAYDFLEAFI--------- 146
             ..|.||...       |...|:|..    .:|...:.|....|:.:..|:|...:         
  Rat   106 -ARHRESNTAGIDIFSKFSAYIKNTK----QQNNAALERGLTKALRKLDDYLNTPLPEEIDTNTH 165

  Fly   147 ----GNQ-AYLCGPVITIADYSVVSSVSSLVGLAAIDAKRY 182
                |:| .:|.|..:|:||.:::..:.    :..|.||:|
  Rat   166 GDEKGSQRKFLDGDELTLADCNLLPKLH----VVKIVAKKY 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 38/171 (22%)
GST_N_Delta_Epsilon 4..76 CDD:239343 10/42 (24%)
GST_C_Delta_Epsilon 92..209 CDD:198287 24/112 (21%)
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 12/53 (23%)
O-ClC 14..249 CDD:129941 38/171 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348301
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.