DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and URE2

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:58/248 - (23%)
Similarity:88/248 - (35%) Gaps:75/248 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLED---DGKFIWE 67
            |:...::|......:.|..||..|....::...|||:..||...||...||.|.|   |...|||
Yeast   116 LFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIWE 180

  Fly    68 SHAICAYLVRRYAK--------SDDLYPKD------YFKRA----LVDQRLHFESGVLFQGCIRN 114
            |.||..:||.:|.|        ||||..:.      :|:.:    ::.|.|||.           
Yeast   181 SGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFR----------- 234

  Fly   115 IAIPLFY-KNITEVPRSQIDAIYEAYDFLE--------------------------------AFI 146
                .|: :.|........|.:...|..:|                                .|.
Yeast   235 ----YFHSQKIASAVERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFF 295

  Fly   147 GNQAYLCGPVITIADYSVV--SSVSSLVGLAAIDAK-RYPKLNGWLDRMAAQP 196
            ....:|.|..:||||.:.|  ::|...:|   |:.| .:|::..|...|..:|
Yeast   296 DYPVWLVGDKLTIADLAFVPWNNVVDRIG---INIKIEFPEVYKWTKHMMRRP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 58/248 (23%)
GST_N_Delta_Epsilon 4..76 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 92..209 CDD:198287 25/145 (17%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 27/77 (35%)
GST_C_Ure2p 208..350 CDD:198326 26/156 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.