DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GTT1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:48/209 - (22%)
Similarity:81/209 - (38%) Gaps:29/209 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RACKL--TLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLE----DDG--KFIWESHAIC 72
            ||.:|  .||.|.|:||.......|......|....:|....|:||    :.|  |.:.||..|.
Yeast    15 RAFRLLWLLDHLNLEYEIVPYKRDANFRAPPELKKIHPLGRSPLLEVQDRETGKKKILAESGFIF 79

  Fly    73 AYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVL--------FQGCIRNIAIPLFYKNITEVPR 129
            .|:::.:..|..|..:|......::..|.:..|.|        ....:::..:|.   .|:.:.|
Yeast    80 QYVLQHFDHSHVLMSEDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPF---PISYLAR 141

  Fly   130 SQIDAIYEAY---------DFLEAFIG-NQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPK 184
            ...|.|.:||         ||:|..|. |..||....::.||..:...:...........:.||.
Yeast   142 KVADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFPLQMAFERKFAAPEDYPA 206

  Fly   185 LNGWLDRMAAQPNY 198
            ::.||..:.::.:|
Yeast   207 ISKWLKTITSEESY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 48/209 (23%)
GST_N_Delta_Epsilon 4..76 CDD:239343 21/67 (31%)
GST_C_Delta_Epsilon 92..209 CDD:198287 24/125 (19%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 21/71 (30%)
GST_C_GTT1_like 93..218 CDD:198298 24/127 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.