DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GTT2

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:55/214 - (25%)
Similarity:91/214 - (42%) Gaps:21/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLVLYGVEASPPVRACKLTLDALGL--QYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLE-DDGKF 64
            |:::|...|.|.....::.|....:  ..::..:||..||||..||..||...|||||| |||..
Yeast    18 KMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDDGTL 82

  Fly    65 IWESHAICAYLVRRYAKSDDLYPKDYFKRALV---DQRLHFE----SGVLFQGCIRNIAIPL-FY 121
            |.|..||..| :.....:..|..|...::.::   ::|...|    ..|.|......:...: .|
Yeast    83 IAECTAITEY-IDALDGTPTLTGKTPLEKGVIHMMNKRAELELLDPVSVYFHHATPGLGPEVELY 146

  Fly   122 KNITEVPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPK-- 184
            :| .|....|.|.......:.:..:..:.|:.|...::||.:|::.:.    .|||...:.|:  
Yeast   147 QN-KEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLI----FAAIVKLQVPEEC 206

  Fly   185 --LNGWLDRMAAQPNYQSL 201
              |..|..||..:|:.:.|
Yeast   207 EALRAWYKRMQQRPSVKKL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 53/211 (25%)
GST_N_Delta_Epsilon 4..76 CDD:239343 28/74 (38%)
GST_C_Delta_Epsilon 92..209 CDD:198287 24/122 (20%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 28/75 (37%)
GST_C_GTT2_like 106..222 CDD:198291 23/120 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345145
Domainoid 1 1.000 43 1.000 Domainoid score I3172
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1708
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.