DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and clic3

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:202 Identity:43/202 - (21%)
Similarity:75/202 - (37%) Gaps:67/202 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RACKLTLD-ALGLQYEYRLVNLLAGE-----HKTKEF---SLKNPQHTVPVL-------EDDGKF 64
            ||.::..| |.|.|..:.:.|   ||     :|.:||   :|..||:  |.|       ...|..
Zfish    49 RAPEVLKDLAPGSQPPFLIYN---GEVRTDTNKIEEFLEDTLAPPQY--PKLCCRYKESNTAGDD 108

  Fly    65 IWESHAICAYLVRRYAKSDDLYPKDYFKRAL-VDQRLHFESGVLFQGCIRNIAIPLFYKNITEVP 128
            |:  |...||:.......:|:..|.:.|..: :||.|                       :|.:|
Zfish   109 IF--HKFSAYIKNPNPGLNDMLEKKFLKSLMKLDQYL-----------------------LTPLP 148

  Fly   129 RSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRY------PKLNG 187
                   :|.....|.....:.||.|..:::||.:::..:.    :..:..|:|      .:|.|
Zfish   149 -------HELDQNPELSTSTRHYLDGNALSLADCNLLPKLH----IVKVVCKKYRGFEIPAELKG 202

  Fly   188 ---WLDR 191
               :||:
Zfish   203 LSKYLDK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 43/202 (21%)
GST_N_Delta_Epsilon 4..76 CDD:239343 22/75 (29%)
GST_C_Delta_Epsilon 92..209 CDD:198287 19/110 (17%)
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 14/45 (31%)
O-ClC 6..237 CDD:129941 43/202 (21%)
GST_C_CLIC3 99..231 CDD:198332 26/147 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589612
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.