Sequence 1: | NP_725784.1 | Gene: | GstE9 / 246581 | FlyBaseID: | FBgn0063491 | Length: | 221 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955818.1 | Gene: | clic3 / 84040 | ZFINID: | ZDB-GENE-010507-2 | Length: | 239 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 43/202 - (21%) |
---|---|---|---|
Similarity: | 75/202 - (37%) | Gaps: | 67/202 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 RACKLTLD-ALGLQYEYRLVNLLAGE-----HKTKEF---SLKNPQHTVPVL-------EDDGKF 64
Fly 65 IWESHAICAYLVRRYAKSDDLYPKDYFKRAL-VDQRLHFESGVLFQGCIRNIAIPLFYKNITEVP 128
Fly 129 RSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRY------PKLNG 187
Fly 188 ---WLDR 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE9 | NP_725784.1 | GstA | 4..201 | CDD:223698 | 43/202 (21%) |
GST_N_Delta_Epsilon | 4..76 | CDD:239343 | 22/75 (29%) | ||
GST_C_Delta_Epsilon | 92..209 | CDD:198287 | 19/110 (17%) | ||
clic3 | NP_955818.1 | GST_N_CLIC | 3..92 | CDD:239359 | 14/45 (31%) |
O-ClC | 6..237 | CDD:129941 | 43/202 (21%) | ||
GST_C_CLIC3 | 99..231 | CDD:198332 | 26/147 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589612 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |