DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GSTF6

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:219 Identity:52/219 - (23%)
Similarity:97/219 - (44%) Gaps:30/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFI 65
            |..:.::|..||...|...:.|....:.:|:..|.|..||||.:.|.|:||...||..||....|
plant     1 MAGIKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKI 65

  Fly    66 WESHAICAYLVRRYA-KSDDLYP--KDYFKRALVDQRLHFE--------SGVLFQGCIRNIAIPL 119
            :||.||..|:...:: |.::|..  ||   .|::...:..|        |.::::..::    ||
plant    66 FESRAITQYIAHEFSDKGNNLLSTGKD---MAIIAMGIEIESHEFDPVGSKLVWEQVLK----PL 123

  Fly   120 F----YKNITEVPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAA---I 177
            :    .|.:.|...:::..:.:.|   |..:|...||.....|:.|...:..:..|:|...   .
plant   124 YGMTTDKTVVEEEEAKLAKVLDVY---EHRLGESKYLASDHFTLVDLHTIPVIQYLLGTPTKKLF 185

  Fly   178 DAKRYPKLNGWLDRMAAQPNYQSL 201
            |.:  |.::.|:..:.::|:.|.:
plant   186 DER--PHVSAWVADITSRPSAQKV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 51/214 (24%)
GST_N_Delta_Epsilon 4..76 CDD:239343 26/71 (37%)
GST_C_Delta_Epsilon 92..209 CDD:198287 21/125 (17%)
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 26/72 (36%)
GST_C_Phi 91..208 CDD:198296 23/129 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.