DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GSTF5

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:215 Identity:55/215 - (25%)
Similarity:93/215 - (43%) Gaps:34/215 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHA 70
            :||...|...|.....|...||.|:...|||:||:.|...|...||...|||..|.|..:.||.|
plant    66 IYGYPYSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRA 130

  Fly    71 ICAYL--VRRYAKSDDLYPKDYFKRALVDQRL-----HFE-----SGVLFQGCIRNIAIPLF--- 120
            |..|:  |.:...:..|..|.|  :.:..||:     .||     |.:.::..|:    |::   
plant   131 ISEYIATVHKSRGTQLLNYKSY--KTMGTQRMWMAIESFEFDPLTSTLTWEQSIK----PMYGLK 189

  Fly   121 --YKNITEVPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRY- 182
              ||.:.|. .::::.:.:.|   |..:.|.::|.....|:||...:.::..|:.   ...||. 
plant   190 TDYKVVNET-EAKLEKVLDIY---EERLKNSSFLASNSFTMADLYHLPNIQYLMD---THTKRMF 247

  Fly   183 ---PKLNGWLDRMAAQPNYQ 199
               |.:..|:..:.|:|.::
plant   248 VNRPSVRRWVAEITARPAWK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 55/215 (26%)
GST_N_Delta_Epsilon 4..76 CDD:239343 27/71 (38%)
GST_C_Delta_Epsilon 92..209 CDD:198287 24/127 (19%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 27/69 (39%)
GST_C_Phi 153..270 CDD:198296 24/126 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.