DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GSTF7

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:219 Identity:50/219 - (22%)
Similarity:88/219 - (40%) Gaps:37/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFI 65
            |..:.::|..||...|...:.|....|.:|:..:.|..||||.:.|..:||...||..||....:
plant     1 MAGIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKL 65

  Fly    66 WESHAICAYLVRRYAKSDD----LYPKDYFKRAL-----------VDQRLHFESGVLFQGCIRNI 115
            :||.||..|:...|:...:    |..||....|:           |..:|.:|          .:
plant    66 FESRAITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWE----------QV 120

  Fly   116 AIPLF----YKNITEVPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAA 176
            ..||:    .|.:.|...:::..:.:.|   |..:|...||.....|:.|...:..:..|:|...
plant   121 LKPLYGMTTDKTVVEEEEAKLAKVLDVY---EHRLGESKYLASDKFTLVDLHTIPVIQYLLGTPT 182

  Fly   177 ---IDAKRYPKLNGWLDRMAAQPN 197
               .|.:  |.::.|:..:.::|:
plant   183 KKLFDER--PHVSAWVADITSRPS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 49/216 (23%)
GST_N_Delta_Epsilon 4..76 CDD:239343 24/71 (34%)
GST_C_Delta_Epsilon 92..209 CDD:198287 21/124 (17%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 24/72 (33%)
GST_C_Phi 95..209 CDD:198296 21/125 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.