DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GSTF4

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:205 Identity:49/205 - (23%)
Similarity:82/205 - (40%) Gaps:22/205 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHA 70
            ::|...|...|.....|....|.||...|.|..|||||:.|...||...|||.||....::||.|
plant    39 VHGDPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRA 103

  Fly    71 ICAYLVRRYAKSDD----LYPKDYFKRALVDQRLHFE--------SGVLFQGCIRNIAIPLFYKN 123
            |..|:.  |..|..    |..:.:...|.:...:..|        |.:.::..|:    |::...
plant   104 ITQYIA--YVHSSRGTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIK----PIYGLE 162

  Fly   124 ITEVPRSQIDAIYE-AYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAA--IDAKRYPKL 185
            ..:....:.:||.| ..:..|..:....:|.....|:.|...:.::..|:|...  :..|| .|:
plant   163 TDQTIVKENEAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQYLLGTPTKKLFEKR-SKV 226

  Fly   186 NGWLDRMAAQ 195
            ..|:|.:.::
plant   227 RKWVDEITSR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 49/205 (24%)
GST_N_Delta_Epsilon 4..76 CDD:239343 27/69 (39%)
GST_C_Delta_Epsilon 92..209 CDD:198287 19/115 (17%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 27/69 (39%)
GST_C_Phi 126..243 CDD:198296 19/116 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.