DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and Clic4

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_114006.1 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:179 Identity:30/179 - (16%)
Similarity:60/179 - (33%) Gaps:68/179 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LVNLLAGEH---------------KTKEF-------------SLKNPQHTVPVLEDDGKFIWESH 69
            |.||..|.|               |.:||             |.|:|:.....::...||     
  Rat    66 LQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKF----- 125

  Fly    70 AICAYLVRRYAKSDDLYPKDYFKR-ALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQID 133
              .||:.....::::...:...|. ..:|:.|             |..:|      .|:..:.::
  Rat   126 --SAYIKNSRPEANEALERGLLKTLQKLDEYL-------------NSPLP------GEIDENSME 169

  Fly   134 AIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRY 182
            .|..:         .:.:|.|..:|:||.:::..:.    :..:.||:|
  Rat   170 DIKSS---------TRRFLDGDEMTLADCNLLPKLH----IVKVVAKKY 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 30/179 (17%)
GST_N_Delta_Epsilon 4..76 CDD:239343 15/70 (21%)
GST_C_Delta_Epsilon 92..209 CDD:198287 15/92 (16%)
Clic4NP_114006.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 8/34 (24%)
GST_N_CLIC 14..104 CDD:239359 8/37 (22%)
O-ClC 17..252 CDD:129941 30/179 (17%)
GST_C_family 111..251 CDD:295467 20/134 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347853
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.