DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GSTT2

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:254 Identity:67/254 - (26%)
Similarity:98/254 - (38%) Gaps:47/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWE 67
            ||.:|....|.|.||..:......:|::..|::|...:..:.||...||...||.:.|....::|
plant     2 KLKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFE 66

  Fly    68 SHAICAYLVRRYAK-SDDLYPKDYFKRALVDQRLHFE--------SGVLFQGCIR-NIAIPLFYK 122
            ||||..||...||. .|..||.|..|||.:...|.:.        ||.:....:. .:.:||..|
plant    67 SHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPALGLPLNPK 131

  Fly   123 NITEVPRSQIDAIYEAYDFLEAF--IGNQAYLCG---PVITIADYSVVSSVSSLVGLAAIDAKR- 181
            ...|..    :.:..:...||.|  .|:..:|.|   |  :|||.|:|..:..|..|...|..| 
plant   132 AAAEAE----NILTNSLSTLETFWLKGSAKFLLGGKQP--SIADLSLVCELMQLQVLDDKDRLRL 190

  Fly   182 ---YPKLNGWL----------------------DRMAAQPNYQSLNGNGAQMLIDMFSS 215
               :.|:..|:                      ||...|....:.:..|.|..|..|||
plant   191 LSPHKKVEQWIESTRKATMPHSDEVHEVLFRAKDRFQKQREMATASKPGPQSKIIQFSS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 60/237 (25%)
GST_N_Delta_Epsilon 4..76 CDD:239343 22/71 (31%)
GST_C_Delta_Epsilon 92..209 CDD:198287 33/156 (21%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 23/74 (31%)
GST_C_Theta 92..221 CDD:198292 28/134 (21%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.