DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GSTT1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:223 Identity:64/223 - (28%)
Similarity:100/223 - (44%) Gaps:35/223 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLVLYGVEASPPVRA----CKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDD 61
            |.||.:|....|.|.||    ||:.    |:|::..|::|...:..:.||...||...||.:.|.
plant     1 MMKLKVYADRMSQPSRAVIIFCKVN----GIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDG 61

  Fly    62 GKFIWESHAICAYLVRRY-AKSDDLYPKDYFKRALVDQRLHFESGVLFQGC---IRN------IA 116
            ...::|||||..||...: :.:|..||.|..|||.:...|.:....|.:|.   :.|      :.
plant    62 RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYVLNSVLGPALG 126

  Fly   117 IPLFYKNITEVPRSQIDAIYEAYDFLEAF--IGNQAYLCG---PVITIADYSVVSSVSSLVGLAA 176
            :||..|...|..:    .:.::...||.|  .||..:|.|   |  :|||.|:|..:..|..|..
plant   127 LPLNPKAAAEAEQ----LLTKSLSTLETFWLKGNAKFLLGSNQP--SIADLSLVCELMQLQVLDD 185

  Fly   177 IDAKR----YPKLNGWLD--RMAAQPNY 198
            .|..|    :.|:..|::  :.|..|::
plant   186 KDRLRLLSTHKKVEQWIENTKKATMPHF 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 62/220 (28%)
GST_N_Delta_Epsilon 4..76 CDD:239343 25/75 (33%)
GST_C_Delta_Epsilon 92..209 CDD:198287 32/127 (25%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 26/78 (33%)
GST_C_Theta 93..223 CDD:198292 32/127 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.