DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GSTF12

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:208 Identity:54/208 - (25%)
Similarity:99/208 - (47%) Gaps:16/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYG-VEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESH 69
            ||| |.|:.|.|.....|:. |:::|...::|...|.|..|..|:.|...||.:||....::||.
plant     5 LYGQVTAACPQRVLLCFLEK-GIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESR 68

  Fly    70 AICAYLVRRYA-KSDDLYPKDYFKRALVDQRLHFES---GVLFQGCIRNIAI-PLFYKN----IT 125
            ||..|...::| :..:|..|....||:|||....|:   .||.|..:.|:.| |...:.    :.
plant    69 AIARYYATKFADQGTNLLGKSLEHRAIVDQWADVETYYFNVLAQPLVINLIIKPRLGEKCDVVLV 133

  Fly   126 EVPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAID--AKRYPKLNGW 188
            |..:.::..:.:.|:   ..:.:..:|.|...|:||.:.:.::..|:.:..|:  .|.....|.|
plant   134 EDLKVKLGVVLDIYN---NRLSSNRFLAGEEFTMADLTHMPAMGYLMSITDINQMVKARGSFNRW 195

  Fly   189 LDRMAAQPNYQSL 201
            .:.::.:|:::.|
plant   196 WEEISDRPSWKKL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 53/206 (26%)
GST_N_Delta_Epsilon 4..76 CDD:239343 25/70 (36%)
GST_C_Delta_Epsilon 92..209 CDD:198287 26/120 (22%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 54/208 (26%)
GST_N_Phi 2..77 CDD:239351 25/72 (35%)
GST_C_Phi 91..209 CDD:198296 26/121 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.