DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:214 Identity:61/214 - (28%)
Similarity:92/214 - (42%) Gaps:34/214 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHA 70
            |||.|.|..|....|.|.....::|...|||.|..||...|...||...||.|:||...::||.|
plant     5 LYGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFESRA 69

  Fly    71 ICAYLVRRYA-KSDDLYPKDYFKRALV------DQRLHFE---SGVLFQGCIRNIAIPLFYKN-- 123
            |.||:..::. |..||...:..|.|.:      .:..||.   |.|:.|    .|.:||..::  
plant    70 ITAYIAEKHRDKGTDLTRHEDPKEAAIVKLWSEVEAHHFNPAISAVIHQ----LIVVPLQGESPN 130

  Fly   124 --ITEVPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIAD-------YSVVSSVSSLVGLAAIDA 179
              |.|.....:..|.:.|   |..:|...||.|...|:||       |..:.::.:  ||  |:.
plant   131 AAIVEENLENLGKILDVY---EERLGKTKYLAGDTYTLADLHHVPYTYYFMKTIHA--GL--IND 188

  Fly   180 KRYPKLNGWLDRMAAQPNY 198
            :  |.:..|.:.:.::|.:
plant   189 R--PNVKAWWEDLCSRPAF 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 61/214 (29%)
GST_N_Delta_Epsilon 4..76 CDD:239343 29/69 (42%)
GST_C_Delta_Epsilon 92..209 CDD:198287 29/127 (23%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 61/214 (29%)
GST_N_Phi 2..77 CDD:239351 29/71 (41%)
GST_C_Phi 92..208 CDD:198296 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.