DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GSTF8

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 / 819386 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana


Alignment Length:208 Identity:57/208 - (27%)
Similarity:96/208 - (46%) Gaps:16/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFI 65
            |..:.::||..|........||....||:|...|::.||.||.:.....||...:|.|||....:
plant    49 MASIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDLTL 113

  Fly    66 WESHAICAYLVRRYA-KSDDLYPKDYFK-RALVDQRLHFESGVLFQGCIRNIAIPLFYK---NIT 125
            :||.||..||...|: |.:.|..:|..| :|..:..|..| |..|......:|....:|   .:|
plant   114 FESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVE-GQQFDPNASKLAFERVFKGMFGMT 177

  Fly   126 EVPRS--QIDA-IYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAK----RYP 183
            ..|.:  :::. :.:..|..||.:....:|.|...|:||...:.::..|:|   .|:|    ..|
plant   178 TDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLG---TDSKVLFDSRP 239

  Fly   184 KLNGWLDRMAAQP 196
            |::.|:.:::|:|
plant   240 KVSEWIKKISARP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 56/205 (27%)
GST_N_Delta_Epsilon 4..76 CDD:239343 24/71 (34%)
GST_C_Delta_Epsilon 92..209 CDD:198287 27/116 (23%)
GSTF8NP_001323480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.