DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GSTF10

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:209 Identity:52/209 - (24%)
Similarity:97/209 - (46%) Gaps:13/209 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWES 68
            |.:|....:...||. :||...|:.:|...|:|:.||.:..|:....|...:|||.|....|:||
plant     3 LTIYAPLFASSKRAV-VTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFES 66

  Fly    69 HAICAYLVRRY-AKSDDLYPKDYFKRALVDQRLHFES----GVLFQGCIRNIAIPLF-YKNITEV 127
            .||..|:..:| ::..||..|...:|..|:|.|..|:    ..|....:..:..||. :....:|
plant    67 RAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKV 131

  Fly   128 PRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVG----LAAIDAKRYPKLNGW 188
            .:...:.:.|..|..||.:....||.|..:::||.:.:.....|||    ...|..:::  ::.|
plant   132 IKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPIGKAHLIKDRKH--VSAW 194

  Fly   189 LDRMAAQPNYQSLN 202
            .|:::::..::.::
plant   195 WDKISSRAAWKEVS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 52/206 (25%)
GST_N_Delta_Epsilon 4..76 CDD:239343 24/71 (34%)
GST_C_Delta_Epsilon 92..209 CDD:198287 24/120 (20%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 52/209 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.