DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GSTF9

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:205 Identity:53/205 - (25%)
Similarity:95/205 - (46%) Gaps:11/205 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWES 68
            |.:||...:.|.||. :||...|:.:|...|:|:.||||...:....|..|||.:.|....|:||
plant     3 LKVYGPHFASPKRAL-VTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFES 66

  Fly    69 HAICAYLVRRY-AKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVP---- 128
            .|:..|:..:| ::..||..|....|..|:|.|..|: ..:...:.|:.:.:.:.::...|    
plant    67 RAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEA-TTYHPPLLNLTLHIMFASVMGFPSDEK 130

  Fly   129 --RSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGL--AAIDAKRYPKLNGWL 189
              :...:.:....|..||.:....||.|..:::||.:.:.....|||.  .|...|....::.|.
plant   131 LIKESEEKLAGVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPIGKAYMIKDRKHVSAWW 195

  Fly   190 DRMAAQPNYQ 199
            |.::::|.::
plant   196 DDISSRPAWK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 53/205 (26%)
GST_N_Delta_Epsilon 4..76 CDD:239343 26/71 (37%)
GST_C_Delta_Epsilon 92..209 CDD:198287 23/116 (20%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 53/205 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.