DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GSTF3

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:208 Identity:53/208 - (25%)
Similarity:91/208 - (43%) Gaps:14/208 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFI 65
            |..:.::|..||...|...:.|....|.:|...|.|..||||.:.|..:||...||..||....:
plant     1 MAGIKVFGHPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKL 65

  Fly    66 WESHAICAYLVRRYA-KSDDLYP---KDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYK---- 122
            :||.||..|:..||. :..:|.|   |:..:.|::...:..|:. .|......:|....:|    
plant    66 FESRAITQYIAHRYENQGTNLLPADSKNIAQYAIMSIGIQVEAH-QFDPVASKLAWEQVFKFNYG 129

  Fly   123 -NITEVPRSQIDA-IYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAA--IDAKRYP 183
             |..:...::.:| :.:..|..||.:....||.|...|:.|...:..:..|:|...  :..:| |
plant   130 LNTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLGTPTKKLFTER-P 193

  Fly   184 KLNGWLDRMAAQP 196
            ::|.|:..:..:|
plant   194 RVNEWVAEITKRP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 52/205 (25%)
GST_N_Delta_Epsilon 4..76 CDD:239343 25/71 (35%)
GST_C_Delta_Epsilon 92..209 CDD:198287 22/113 (19%)
GSTF3NP_178394.1 PLN02473 4..212 CDD:166114 52/205 (25%)
GST_N_Phi 4..78 CDD:239351 25/73 (34%)
GST_C_Phi 96..212 CDD:198296 22/113 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.