DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and Gstt4

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001103145.1 Gene:Gstt4 / 686922 RGDID:1591294 Length:240 Species:Rattus norvegicus


Alignment Length:169 Identity:57/169 - (33%)
Similarity:86/169 - (50%) Gaps:10/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFI 65
            || |.||....|.|.||..:.....|:.::::.|:||.|.|.:||:...||...||.|. |||||
  Rat     1 MG-LELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKVPSLR-DGKFI 63

  Fly    66 W-ESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNIT--EV 127
            . ||.||..||.|:|:.....||.|...||.||:.:.::...:.....:.:.|.|....||  ||
  Rat    64 LSESVAILCYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMITGEEV 128

  Fly   128 PRSQIDAIYEAYD-----FLEAFIGNQAYLCGPVITIAD 161
            |..::|...:..:     |.|.|:.::.::.|..|::||
  Rat   129 PTERLDKTLDEVNKNIKQFEEKFLQDKLFITGDHISLAD 167

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 55/166 (33%)
GST_N_Delta_Epsilon 4..76 CDD:239343 30/72 (42%)
GST_C_Delta_Epsilon 92..209 CDD:198287 19/77 (25%)
Gstt4NP_001103145.1 GST_N_Theta 3..78 CDD:239348 32/75 (43%)