DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and Gsto2

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_080895.2 Gene:Gsto2 / 68214 MGIID:1915464 Length:248 Species:Mus musculus


Alignment Length:207 Identity:54/207 - (26%)
Similarity:88/207 - (42%) Gaps:29/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDG-KFI 65
            |.:.:|.:...|.....:|.|.|.|:::|...:||   :.|...:..|:|...:||||:.. :.:
Mouse    22 GVIRIYSMRFCPYSHRARLVLKAKGIRHEVININL---KSKPDWYYTKHPFGQIPVLENSQCQLV 83

  Fly    66 WESHAICAYLVRRYAKSDDLY------PKDYFKRALVDQRLHFESGV--LFQGCIRNIAIPLFYK 122
            :||...|.||       ||:|      |.|.::||.....|.....|  |.:.|:  ||:.. .:
Mouse    84 YESVIACEYL-------DDVYPGRKLFPYDPYERARQKMLLELFCKVPPLSKECL--IALRC-GR 138

  Fly   123 NITEVPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSL--VGLAAIDAKRY-PK 184
            :.|::..:....:....:.||  ..|..:..|..|::.||.|......|  .|||  |...: |.
Mouse   139 DCTDLKVALRQELCNMEEILE--YQNTTFFGGDCISMIDYLVWPWFERLDVYGLA--DCVNHTPM 199

  Fly   185 LNGWLDRMAAQP 196
            |..|:..|...|
Mouse   200 LRLWIASMKQDP 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 53/205 (26%)
GST_N_Delta_Epsilon 4..76 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 92..209 CDD:198287 27/110 (25%)
Gsto2NP_080895.2 GST_N_Omega 6..94 CDD:239353 22/81 (27%)