DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and Gstz1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001102915.1 Gene:Gstz1 / 681913 RGDID:1589363 Length:216 Species:Rattus norvegicus


Alignment Length:193 Identity:54/193 - (27%)
Similarity:90/193 - (46%) Gaps:17/193 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLL--AGEHKTKEFSLKNPQHTVPVLEDDGKF 64
            ||.|||....|......::.|...|:.||...:||:  .|:..::||...||...||.|:.||..
  Rat     4 GKPVLYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPALKIDGIT 68

  Fly    65 IWESHAICAYL--VRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGC--IRNIAIPLFYKNIT 125
            |.:|.||..||  .|...:   |.|:|..|||:|    ...|.::..|.  ::|:::........
  Rat    69 IGQSLAILEYLEETRPIPR---LLPQDPQKRAIV----RMISDLIASGIQPLQNLSVLKQVGQEN 126

  Fly   126 EVPRSQIDAIYEAYDFLEAFIGNQA--YLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLN 186
            ::|.:| .||...::.||..:.:.|  |..|..:::||..:...|::.... .:|...||.::
  Rat   127 QMPWAQ-KAITSGFNALEKILQSTAGKYCVGDEVSMADVCLAPQVANAERF-KVDLSPYPTIS 187

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 52/191 (27%)
GST_N_Delta_Epsilon 4..76 CDD:239343 26/75 (35%)
GST_C_Delta_Epsilon 92..209 CDD:198287 22/99 (22%)
Gstz1NP_001102915.1 GST_N_Zeta 6..80 CDD:239340 25/73 (34%)
maiA 7..211 CDD:273527 52/190 (27%)
Glutathione binding. /evidence=ECO:0000250 14..19 1/4 (25%)