DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GstD10

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:197 Identity:70/197 - (35%)
Similarity:104/197 - (52%) Gaps:26/197 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGVEASPPVRACKLTLDALGLQYEYR-LVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESH 69
            ||....|.|.|:..:|..|||::::.: ::|..|.|..|.|:...|||||:|.|.|.|..:|||.
  Fly     3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESR 67

  Fly    70 AICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQI-- 132
            ||..|||.:|.|.|.|:|||..|:||::|||:|:.|.|             ||:.:|....||  
  Fly    68 AIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTL-------------YKSFSEYYYPQIFL 119

  Fly   133 ---------DAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGW 188
                     ..|..|::||..|:..|.|..|...::||.:.:::||:. .:|..|.|||..:..|
  Fly   120 KKPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTF-DVAGFDFKRYANVARW 183

  Fly   189 LD 190
            .:
  Fly   184 YE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 70/197 (36%)
GST_N_Delta_Epsilon 4..76 CDD:239343 29/70 (41%)
GST_C_Delta_Epsilon 92..209 CDD:198287 32/110 (29%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 30/71 (42%)
PLN02473 3..196 CDD:166114 70/197 (36%)
GST_C_Delta_Epsilon 89..205 CDD:198287 32/111 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460279
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.