DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and gdap1l1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:275 Identity:56/275 - (20%)
Similarity:93/275 - (33%) Gaps:98/275 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWE 67
            :||||....|...:..:|.::..||..|.|.|:|...|.|...|...|....|||.......:.:
Zfish    47 RLVLYHWTQSFSSQKVRLVINEKGLLCEERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVSD 111

  Fly    68 SHAICAYL-----------------------VRRYAKSDDLYPKDYF-----------------K 92
            .:.|..|:                       |::|.:..|..|.|.:                 |
Zfish   112 YNQIIDYIETNFVGDTVAQLIPDEGTPMYARVQQYRELLDGLPMDAYTHGCILHPELTTDSMIPK 176

  Fly    93 RALVDQRLHFESGVLFQGCIRNIAIPLF-----YKNITEVPRSQIDAI------YEAYDFLEAFI 146
            .|..:.|.|          :.|.|..|.     ...:||...|:...:      ::..::|:..:
Zfish   177 YATAEIRRH----------LANAASELMKLDHEEPQLTEPYLSKQKKLMAKILDHDNVNYLKKIL 231

  Fly   147 GNQA------------------------YLCGPVITIADYSVVSSVSSL--VGLAAIDAKRYPKL 185
            |..|                        :||||..|:||..:.:::..|  :||    :::|   
Zfish   232 GELAMVLDQVEAELEKRKLEYQGQKCELWLCGPTFTLADICLGATLHRLKFLGL----SRKY--- 289

  Fly   186 NGWLDRMAAQPNYQS 200
              |.|  .::||.||
Zfish   290 --WED--GSRPNLQS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 56/274 (20%)
GST_N_Delta_Epsilon 4..76 CDD:239343 21/94 (22%)
GST_C_Delta_Epsilon 92..209 CDD:198287 30/146 (21%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 56/274 (20%)
Thioredoxin_like 48..120 CDD:294274 21/71 (30%)
GST_C_GDAP1L1 201..311 CDD:198335 23/111 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589686
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.