DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GDAP1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens


Alignment Length:294 Identity:60/294 - (20%)
Similarity:91/294 - (30%) Gaps:103/294 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWE 67
            ||:||....|...:..:|.:....|:.|...|:|...||....|...|....||||......|.|
Human    25 KLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICE 89

  Fly    68 SHAICAYLVRRYA----------KSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYK 122
            :..|..||.:.:.          |....||:....|.|:|.   ........|||.:        
Human    90 ATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDS---LPMDAYTHGCILH-------- 143

  Fly   123 NITEVPRSQIDAIYEAY------------------------DFLEAFI----------------- 146
                 |...:|::..||                        |..||:|                 
Human   144 -----PELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVK 203

  Fly   147 ------------------------------GNQAYLCGPVITIADYSVVSSVSSL--VGLAAI-- 177
                                          |.|.:|||...|:||.|:..::..|  :|.|..  
Human   204 YLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNW 268

  Fly   178 -DAKRYPKLNGWLDRMAAQPNYQSLNGNGAQMLI 210
             :.|| |.|..:.:|:..:..:..:.|:...:||
Human   269 GNGKR-PNLETYYERVLKRKTFNKVLGHVNNILI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 56/282 (20%)
GST_N_Delta_Epsilon 4..76 CDD:239343 21/71 (30%)
GST_C_Delta_Epsilon 92..209 CDD:198287 32/192 (17%)
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 21/71 (30%)
GST_C_GDAP1 179..289 CDD:198336 21/110 (19%)
Required for mitochondrial localization 320..358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154570
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.