DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:204 Identity:59/204 - (28%)
Similarity:96/204 - (47%) Gaps:20/204 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLL-AGEHKTKEFSLKNPQHTVPVLEDDGKFIW 66
            :|.||....|.|.|:..:...|..:.:.|..:.|| ||||.|:||...:..|.||.|:|....:.
 Frog     5 ELTLYLDLLSQPCRSVYIFAKANRIPFNYCKLQLLKAGEHLTQEFGKVSVLHKVPALKDGNFTMA 69

  Fly    67 ESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFE--------SGVLFQGCIRNIAIPLFYKN 123
            ||.|:..||.|:|...:..||.|..|||.||:.|.::        |.|.:..|:....:.     
 Frog    70 ESTAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFWTKCVSPTILG----- 129

  Fly   124 ITEVPRSQIDAIYEAY-----DFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYP 183
             .|||..:::|:...:     :|.|.|:||:.::.|..|::||...:..:..::.......:..|
 Frog   130 -KEVPSEKMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVADLVAIVEIMQVIASGVNVFEERP 193

  Fly   184 KLNGWLDRM 192
            ||..|..|:
 Frog   194 KLGSWKQRL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 59/203 (29%)
GST_N_Delta_Epsilon 4..76 CDD:239343 26/72 (36%)
GST_C_Delta_Epsilon 92..209 CDD:198287 27/114 (24%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 28/75 (37%)
GST_C_Theta 95..221 CDD:198292 27/114 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.