DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GstD8

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:199 Identity:72/199 - (36%)
Similarity:110/199 - (55%) Gaps:5/199 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHAICAYLV 76
            |.|.|:..:|..|||:....:|:.::.||....||...||||.:|.|.|||..||||.||..|||
  Fly     9 SAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLV 73

  Fly    77 RRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQIDAIYEAYDF 141
            .:|...|.|||.|..|:|:|:|||:|:.|.|||..:..| .|....|....|.: :..:..|:..
  Fly    74 EKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAI-YPQIRNNHPADPEA-MQKVDSAFGH 136

  Fly   142 LEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGWLDR-MAAQPNYQSLNGNG 205
            |:.|:.:|.|:.|..:||||.::::|||:. .:...|..:||.:..|.:. ....|.::. |.:|
  Fly   137 LDTFLEDQEYVAGDCLTIADIALLASVSTF-EVVDFDIAQYPNVARWYENAKEVTPGWEE-NWDG 199

  Fly   206 AQML 209
            .|::
  Fly   200 VQLI 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 69/189 (37%)
GST_N_Delta_Epsilon 4..76 CDD:239343 28/63 (44%)
GST_C_Delta_Epsilon 92..209 CDD:198287 36/117 (31%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 68/181 (38%)
GST_N_Delta_Epsilon 1..74 CDD:239343 29/64 (45%)
GST_C_Delta_Epsilon 88..204 CDD:198287 36/120 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460266
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.