DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GstD2

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster


Alignment Length:204 Identity:73/204 - (35%)
Similarity:109/204 - (53%) Gaps:9/204 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHAICAYLVRRYA 80
            |...:...||||:...:|:|.:.||....||...|||||:|.|.|:|..||||.||..|||.:|.
  Fly    13 RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77

  Fly    81 KSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQID--AIYEAYDFLE 143
            |.|.|.|.|..|||:::|||:|:.|.|::. ......|||.   |..|.|..|  .|..|:.||:
  Fly    78 KDDYLLPNDPKKRAVINQRLYFDMGTLYES-FAKYYYPLFR---TGKPGSDEDLKRIETAFGFLD 138

  Fly   144 AFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGWLDR-MAAQPNYQSLNGNGAQ 207
            .|:..|.|:.|..:|:||.:::|:||:. .::..|..:|..::.|.|. ....|.:.. |..|..
  Fly   139 TFLEGQEYVAGDQLTVADIAILSTVSTF-EVSEFDFSKYSNVSRWYDNAKKVTPGWDE-NWEGLM 201

  Fly   208 MLIDMFSSK 216
            .:..:|.::
  Fly   202 AMKALFDAR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 70/187 (37%)
GST_N_Delta_Epsilon 4..76 CDD:239343 27/59 (46%)
GST_C_Delta_Epsilon 92..209 CDD:198287 37/119 (31%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 28/60 (47%)
GST_C_Delta_Epsilon 88..204 CDD:198287 37/121 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460253
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.