DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and gsto1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:230 Identity:64/230 - (27%)
Similarity:99/230 - (43%) Gaps:53/230 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLE-DDGKFIWESH 69
            ||.:...|..:..:|.|:|.|::|:...:||   ::|...|..|||...||||| ..|:.|:||.
Zfish    25 LYSMRFCPFAQRTRLVLNAKGIKYDTININL---KNKPDWFLEKNPLGLVPVLETQSGQVIYESP 86

  Fly    70 AICAYLVRRYAKSDDLYPK------DYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYK-NITEV 127
            ..|.||       |::||:      |.|:||  .||:..|   ||     :...|.||| .:...
Zfish    87 ITCEYL-------DEVYPEKKLLPFDPFERA--QQRMLLE---LF-----SKVTPYFYKIPVNRT 134

  Fly   128 PRSQIDAI-YEAYDFLEAFIGNQ-------AYLCGPVITIADYSV---VSSVSSLVGLAAIDAKR 181
            ....:.|: .|..|.|..|  |:       .:..|..||:.||.:   ...:.::.....:|.. 
Zfish   135 KGEDVSALETELKDKLSQF--NEILLKKKSKFFGGDSITMIDYMMWPWFERLETMNLKHCLDGT- 196

  Fly   182 YPKLNGWLDRMAAQPNYQSLNGNGAQMLIDMFSSK 216
             |:|..|.:||...|..::          .|||::
Zfish   197 -PELKKWTERMMEDPTVKA----------TMFSTE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 61/213 (29%)
GST_N_Delta_Epsilon 4..76 CDD:239343 26/70 (37%)
GST_C_Delta_Epsilon 92..209 CDD:198287 29/128 (23%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 27/77 (35%)
GstA 25..210 CDD:223698 60/208 (29%)
GST_C_Omega 107..229 CDD:198293 33/138 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.