DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and clic2

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001002561.2 Gene:clic2 / 436834 ZFINID:ZDB-GENE-040718-299 Length:239 Species:Danio rerio


Alignment Length:113 Identity:25/113 - (22%)
Similarity:36/113 - (31%) Gaps:32/113 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 VLFQGCIRN--IAIPLFYKNITEVPR---------SQIDAIYEAYDFLEAFIGNQA--------- 150
            :|:.|.::.  |.|..|.:.....||         ...|...:.:....|||.|..         
Zfish    72 LLYNGTLKTDFIKIEEFLETTLAPPRYPHLSPRYKESFDVGADIFAKFSAFIKNSPNNAFHEKAL 136

  Fly   151 ---------YLCGPVITIADYSV-VSSVSSLVG--LAAIDAKRYPKLN 186
                     ||..|:....|.:: ||....|.|  |...|....|||:
Zfish   137 LREFKRLDDYLNTPLQDELDQNISVSKRKFLDGNRLTLADCNLLPKLH 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 25/113 (22%)
GST_N_Delta_Epsilon 4..76 CDD:239343
GST_C_Delta_Epsilon 92..209 CDD:198287 25/113 (22%)
clic2NP_001002561.2 O-ClC 11..238 CDD:129941 25/113 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.