DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and MARS1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_004981.2 Gene:MARS1 / 4141 HGNCID:6898 Length:900 Species:Homo sapiens


Alignment Length:158 Identity:34/158 - (21%)
Similarity:67/158 - (42%) Gaps:31/158 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LKNPQHTVPVLE-DDGKFIWESHAICAY--LVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQ 109
            |..|:  ||||: |.|.:::.:.|||.|  |:..:.:.|           |.:|.|.:|:..|..
Human    43 LTRPK--VPVLQLDSGNYLFSTSAICRYFFLLSGWEQDD-----------LTNQWLEWEATELQP 94

  Fly   110 GCIRNIAIPLFY-----KNITEVPRSQIDAIYEAYDFLEAFIGNQ--AYLCGPVITIADYSVVSS 167
            .    ::..|:|     |...:|    :.::..|...::..:..|  .:|.|...::||..:..:
Human    95 A----LSAALYYLVVQGKKGEDV----LGSVRRALTHIDHSLSRQNCPFLAGETESLADIVLWGA 151

  Fly   168 VSSLVGLAAIDAKRYPKLNGWLDRMAAQ 195
            :..|:...|...:....|:.|...::.|
Human   152 LYPLLQDPAYLPEELSALHSWFQTLSTQ 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 34/158 (22%)
GST_N_Delta_Epsilon 4..76 CDD:239343 12/30 (40%)
GST_C_Delta_Epsilon 92..209 CDD:198287 20/111 (18%)
MARS1NP_004981.2 Thioredoxin_like <27..68 CDD:294274 11/26 (42%)
GstA <47..189 CDD:223698 32/154 (21%)
GST_C_MetRS_N 77..179 CDD:198340 20/120 (17%)
PRK12268 264..819 CDD:237029
MetRS_core 265..633 CDD:173907
'HIGH' region 273..283
'KMSKS' region 593..597
Anticodon_Ia_Met 642..771 CDD:153411
MetRS_RNA 845..889 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.