DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GstZ2

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster


Alignment Length:211 Identity:50/211 - (23%)
Similarity:90/211 - (42%) Gaps:26/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLYGVEASPPVRACKLTLDALGLQYEYRLVNLL--AGEHKTKEFSLKNPQHTVPVLEDDGKFIWE 67
            :||....|......::.::...:.|:.:.::|:  .||....|:...||...||.|:.||..:.|
  Fly    17 ILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIE 81

  Fly    68 SHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGC--IRNIAIPLFYKNITEVPRS 130
            |.||..|| ........|.|:|..|||.|.:.:.    ::..|.  ::|:.:.:   ::.|..:.
  Fly    82 SVAIMHYL-EETRPQRPLLPQDVHKRAKVREIVE----IICSGIQPLQNLIVLI---HVGEEKKK 138

  Fly   131 QIDA--IYEAYDFLEAFIGNQA--YLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGWLDR 191
            :...  |...:..:|..:...|  |..|..|::||..:|..|.: .....:|.:.||.:.. :||
  Fly   139 EWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFN-ARRFHVDLRPYPIILR-IDR 201

  Fly   192 --------MAAQPNYQ 199
                    .||.|:.|
  Fly   202 ELESNPAFRAAHPSNQ 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 50/211 (24%)
GST_N_Delta_Epsilon 4..76 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 92..209 CDD:198287 26/122 (21%)
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 21/73 (29%)
maiA 17..221 CDD:273527 50/211 (24%)
GST_C_Zeta 104..217 CDD:198300 25/121 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460405
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.