DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and gfzf

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster


Alignment Length:208 Identity:71/208 - (34%)
Similarity:112/208 - (53%) Gaps:12/208 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHA 70
            ||.|...||..|.::||.||.:||:...|:..|.||:::|:|..|||..:|||:|||.::.||.|
  Fly   814 LYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESIA 878

  Fly    71 ICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQIDAI 135
            |..||..:||....|||:|...||:::|||.|..|..:.....:...|:|: :....|.| :..:
  Fly   879 IMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFF-DYKRTPMS-LKKV 941

  Fly   136 YEAYDFLEAF---IGNQAYLCGPVITIADYSVVSSVSSLVGLAAI--DAKRYPKLNGWLDRMAAQ 195
            ..|.|..|.:   :|.: |..|..|||||::::|:.   :.|.||  |..::..:|.|.:....:
  Fly   942 QNALDVFETYLQRLGTK-YAAGENITIADFALISAT---ICLEAINFDLHQFTLVNKWYETFKVE 1002

  Fly   196 -PNYQSLNGNGAQ 207
             |....:..:|.|
  Fly  1003 YPQLWEIANSGMQ 1015

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 69/200 (35%)
GST_N_Delta_Epsilon 4..76 CDD:239343 32/69 (46%)
GST_C_Delta_Epsilon 92..209 CDD:198287 32/122 (26%)
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 33/71 (46%)
GstA 812..1000 CDD:223698 68/191 (36%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 32/122 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I643
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
87.920

Return to query results.
Submit another query.