DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and clic5b

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:168 Identity:36/168 - (21%)
Similarity:62/168 - (36%) Gaps:35/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NLLAGEHKTKEFSLKN--PQHTVPVLEDDG----------KFIWESHAICAY--LVRRYAKS--- 82
            |:...:.|.|...|.|  |....|.|..:|          :|:.|..|...|  |..|:.:|   
Zfish   208 NVTTVDLKRKPADLHNLAPGTHPPFLTFNGEVKTDVNKIEEFLEEVLAPPKYPKLAARHRESNAA 272

  Fly    83 -DDLYPK--DYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQIDAIYEAYDFLEA 144
             :|::.|  .:.|....|.....|.|           :....|.:.|...|.:....:|....|.
Zfish   273 GNDIFAKFSAFIKNTKPDANEALEKG-----------LTKALKKLDEYLNSPLPDEVDADSMEEE 326

  Fly   145 FIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRY 182
            ...|:.:|.|..:|:||.:::..:.    :..:.||:|
Zfish   327 KASNRRFLDGNDLTLADCNLLPKLH----IVKVVAKKY 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 36/168 (21%)
GST_N_Delta_Epsilon 4..76 CDD:239343 13/54 (24%)
GST_C_Delta_Epsilon 92..209 CDD:198287 18/91 (20%)
clic5bNP_998062.1 GST_N_CLIC 170..259 CDD:239359 12/50 (24%)
O-ClC 172..407 CDD:129941 36/168 (21%)
GST_C_CLIC5 266..406 CDD:198330 21/110 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589719
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.