DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and gstt1b

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:241 Identity:61/241 - (25%)
Similarity:104/241 - (43%) Gaps:46/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHAICAYLV 76
            |.|.|:..:......:|::|:.::|..|....:||...||....|.::|....:.||.||..||.
Zfish    11 SQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAESVAIMIYLA 75

  Fly    77 RRYAKSDDLYPKDYFKRALVDQ---------RLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQI 132
            .::...|..:|.|..|||.|::         |:|....:.|:     |.||....  .|||:.::
Zfish    76 DKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGAKIIWFK-----ILIPEVLG--AEVPKEKM 133

  Fly   133 DAIYEAYD-----FLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAA-IDA-KRYPKLNGWLD 190
            :...|..:     |.:.|:.::.::.|..|::||  :|:.|..:...|| :|. :..|||..|.|
Zfish   134 ENAEENLNVALQLFQDKFLQDKPFIVGDQISLAD--LVAIVEIMQPFAAGMDVFENRPKLKAWKD 196

  Fly   191 R-----------------MAAQPNYQSLNGNGAQMLIDMFSSKITK 219
            |                 |:.:.|.:.::..|...|.|    ||.|
Zfish   197 RVRVAIGAKLFDEAHQATMSLRDNAKIIDPKGLSPLKD----KILK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 55/221 (25%)
GST_N_Delta_Epsilon 4..76 CDD:239343 18/63 (29%)
GST_C_Delta_Epsilon 92..209 CDD:198287 34/149 (23%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 53/196 (27%)
GST_N_Theta 3..78 CDD:239348 19/66 (29%)
GST_C_Theta 91..217 CDD:198292 32/134 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.